PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy020733
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family WRKY
Protein Properties Length: 199aa    MW: 22147.8 Da    PI: 8.57
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59537279PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.71.1e-33121177360
                -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
       WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers  d+++ ei+Y+geHnh+k
  Ahy020733 121 DGYNWRKYGQKQVKGSEYPRSYYKCTHPNCPVKKKVERSF-DGQIAEIVYKGEHNHPK 177
                9***************************************.***************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.9E-30110179IPR003657WRKY domain
SuperFamilySSF1182902.35E-26118178IPR003657WRKY domain
SMARTSM007743.2E-37119177IPR003657WRKY domain
PROSITE profilePS5081124.122121178IPR003657WRKY domain
PfamPF031062.8E-26121176IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
QDDIFGAALC DSSHKSPNSD TKQSLIYKPM AKLVSRTTVS LLANMGNCRT IQQQSGQSME  60
GGLHHISHER FGTNLSSDLY HSHSITPPSE TTEPCKMMQQ NIEEDQKALT SAINCDRPSY  120
DGYNWRKYGQ KQVKGSEYPR SYYKCTHPNC PVKKKVERSF DGQIAEIVYK GEHNHPKPQP  180
PKRSGTAGMQ GSGMVPDGV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A3e-191211781674WRKY transcription factor 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016207944.11e-147PREDICTED: WRKY transcription factor 44
RefseqXP_016207945.11e-147PREDICTED: WRKY transcription factor 44
RefseqXP_016207946.11e-147PREDICTED: WRKY transcription factor 44
SwissprotQ9ZUU02e-41WRK44_ARATH; WRKY transcription factor 44
TrEMBLI1NA431e-100I1NA43_SOYBN; Uncharacterized protein
STRINGGLYMA19G36100.11e-99(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.24e-45WRKY family protein